PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DS_8F05AE571.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 313aa    MW: 33789.2 Da    PI: 7.8375
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DS_8F05AE571.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.2e-161562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  Traes_6DS_8F05AE571.2 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
                           678*******************************************97 PP

2Myb_DNA-binding50.74e-1668113148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg +++eE++  +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  Traes_6DS_8F05AE571.2  68 RGMFSQEEEDVVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                            788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.461062IPR017930Myb domain
SuperFamilySSF466897.34E-2912109IPR009057Homeodomain-like
SMARTSM007171.6E-111464IPR001005SANT/Myb domain
PfamPF002492.4E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-221669IPR009057Homeodomain-like
CDDcd001671.34E-101862No hitNo description
PROSITE profilePS5129425.29563117IPR017930Myb domain
SMARTSM007171.7E-1467115IPR001005SANT/Myb domain
PfamPF002492.6E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-2570117IPR009057Homeodomain-like
CDDcd001675.27E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGCRSCDKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FSQEEEDVVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMQL  120
GSNSSSNPAS KNASPELLTS MSATTELIMT SGGGGGGGGS TATSTHDHDA NISSSGAISA  180
AEPFVDQHEH QHHHQQQAKN YVFADWMPTA AATAAPGPXX XXXWPASTAS SGNVTPSHGA  240
FVGDQMSGSS YAALQHPHQQ EHHHHHHHQH GSTAAVGAHA GAGGMVAGGG YFDLLNMGDI  300
YGGFTTTNDD LLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-25911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686640.0AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952152.11e-131PREDICTED: transcription factor LAF1-like
SwissprotQ8LPH69e-54MYB86_ARATH; Transcription factor MYB86
TrEMBLW5H3P30.0W5H3P3_WHEAT; Uncharacterized protein
STRINGMLOC_58869.11e-159(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122962735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-53myb domain protein 86
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]